« Back
Home /
Glucagon-Like Peptide-2, GLP-2 (1-33), human - 1 mg

Glucagon-Like Peptide-2, GLP-2 (1-33), human - 1 mg

Item no.	AS-62070
Manufacturer	AnaSpec
Amount	1 mg
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Citations	Cameron, H. et al. JPET 314, 214 (2005).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Glucagon-Like Peptide 1 (GLP-1)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3766.4
Description	This is a fragment of human intestinal growth factor glucagon-like peptide 2, GLP2, containing amino acids 146 to 178. It is an intestinotrophic growth hormone that promotes many aspects of intestinal function, including enhancement of mucosal growth and promotion of nutrient absorption. GLP-2 is a hormone that can rapidly improve intestinal epithelial barrier function.
Product Group	LB1A1Z
Research Area	Diabetes/Metabolism; Hormones; Cell Signaling / Lyophilized
Sequence One-Letter Code	HADGSFSDEMNTILDNLAARDFINWLIQTKITD
GTIN	5400535149932
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-62070-safety-datasheet.pdf