« Back
Home /
TAT-NSF700scr

TAT-NSF700scr

Item no.	AS-62209
Manufacturer	AnaSpec
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Ile-Pro-Pro-Val-Tyr-Phe-Ser-Arg-Leu-Asp-Leu-Asn-Leu-Val-Val-Leu-Leu-Leu-Ala-Gln-Leu-OH
Citations	Morrell, C. et al. JPET 314, 155 (2005).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	TAT (HIV transactivator protein)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4110.2
Manufacturer - Research Area	Cell Permeable & Penetrating peptides / HIV Tat Fragments
Description	This scrambled human immunodeficiency virus (HIV) transactivator of transcription (TAT) N-ethylmaleimide-sensitive factor (NSF) 700scr peptide is used as a control peptide to TAT-NSF700 peptide. It does not inhibit the disassembly activity of NSF in contrast to the TAT-NSF700 which plays a critical role in regulating exocytosis.
Sequence One-Letter Code	YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535149598

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-62209-safety-datasheet.pdf