« Back
Home /
[Arg6]-β-Amyloid (1-42), English Mutation - 0.5 mg

[Arg6]-β-Amyloid (1-42), English Mutation - 0.5 mg

Item no.	AS-63323
Manufacturer	AnaSpec
Amount	0.5 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Biotin
Purity	Peak Area by HPLC ≥95%
Sequence	H-Asp-Ala-Glu-Phe-Arg-Arg-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Citations	Hori, Y. et al. J. Biol. Chem. 282, 4916 (2007).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	beta-amyloid; beta-amyloid (1-42)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4533.5
Description	This is amino acids 1 to 42 beta-amyloid with the England mutation where His6 is replaced by Arg6. This novel familial Alzheimer's disease (FAD) -linked APP mutation accelerates the fibril elongation rate without a concomitant increase in the levels of protofibrils. The proband in the English family was diagnosed at 55 years of age.
Product Group	LB1A3Z
Research Area	Neuroscience / Lyophilized
Sequence One-Letter Code	DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
GTIN	5400535147631
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-63323-safety-datasheet.pdf