« Back
Home /
β-Amyloid (11-42), HiLyte™ Fluor 488-labeled - 0.1 mg

β-Amyloid (11-42), HiLyte™ Fluor 488-labeled - 0.1 mg

Item no.	AS-63327
Manufacturer	AnaSpec
Amount	0.1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Biotin
Purity	Peak Area by HPLC ≥95%
Sequence	Hilyte™ Fluor 488-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Citations	Huse, J. T. et al. J. Biol. Chem. 277, 16278 (2002); Qahwash, I. et al. J. Biol. Chem. 279, 39010 (2004); Liu, K. et al. Biochem. 41, 3128 (2002).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HiLyte Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	beta-amyloid; beta-amyloid (X-42)
Manufacturer - Conjugate / Tag	HiLyte™ Fluor 488
Shipping Temperature	RT
Storage Conditions	- 20 °C Protected from light
Molecular Weight	3692.5
Description	This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyte Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer's diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyte Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).
Product Group	LB1A3Z
Research Area	Neuroscience / Lyophilized
Absorbtion (nm)	503
Emission (nm)	528
Sequence One-Letter Code	HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
GTIN	5400535147617
Detection Method	Fluorescent
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-63327-safety-datasheet.pdf