« Back
Home /
[Met]-β-Amyloid (1-42), 5-TAMRA labeled - 0.1 mg

[Met]-β-Amyloid (1-42), 5-TAMRA labeled - 0.1 mg

Item no.	AS-64519
Manufacturer	AnaSpec
Amount	0.1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	5-TAMRA-Met-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	beta-amyloid; beta-amyloid (1-42)
Manufacturer - Conjugate / Tag	TAMRA
Shipping Temperature	RT
Storage Conditions	- 20 °C Protected from light
Molecular Weight	5058.1
Description	This is b-amyloid (1-42) peptide with an N-terminal methionine is labeled with a fluorescent dye, 5-TAMRA (Ex/Em= 544/572 nm), on the N-terminus.
Product Group	LB1A4Z
Research Area	Neuroscience / Lyophilized
Absorbtion (nm)	544
Emission (nm)	572
Sequence One-Letter Code	5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
GTIN	5400535144043
Detection Method	Fluorescent
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-64519-safety-datasheet.pdf