« Back
Home /
Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37), human, Amide

Pramlintide, Acetate [Pro25, 28, 29]-Amylin(1-37), human, Amide

Item no.	AS-64576-1
Manufacturer	AnaSpec
CASRN	196078-30-5
Amount	1 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides By Organ Breast Cancer
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 acetate salt (S-S Bond)
Citations	McQueen, J. Am. J. Health-System Pharmacy 62 2363 (2005).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Amylin, Islet Amyloid Polypeptide (IAPP)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3949.6
Manufacturer - Research Area	Diabetes/Metabolism; Hormones; Cell Signaling / Insulin/Amylin; Pancreas; GPCR
Description	Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence One-Letter Code	KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge), acetate salt
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535143879

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-64576-1-safety-datasheet.pdf