« Back
Home /
TAT-HA2 Fusion Peptide - 1 mg

TAT-HA2 Fusion Peptide - 1 mg

Item no.	AS-64876
Manufacturer	AnaSpec
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly-OH
Citations	Wadia, J. et al. Nature Med 10, 310 (2004).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	TAT (HIV transactivator protein)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3433.2
Description	This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Product Group	LB1A1Z
Research Area	Cell Permeable & Penetrating peptides / Lyophilized
Sequence One-Letter Code	RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
GTIN	5400535142223
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-64876-safety-datasheet.pdf