« Back
Home /
Tat-Beclin-1

Tat-Beclin-1

Item no.	AS-65467
Manufacturer	AnaSpec
Amount	1 mg
Category	Peptides & Proteins Cell Biology Cell Status Autophagy Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH
Citations	Shoji-Kawata, S. Nature 494, 201-209 (2013); Marquez, RT. Am J Cancer Res 2 (2), 214-221 (2012).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Tat-Beclin,Beclin-1
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Beclin
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3741.3
Manufacturer - Research Area	Cancer & Apoptosis / Autophagy
Description	Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy.
Sequence One-Letter Code	YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535134402

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-65467-safety-datasheet.pdf