« Back
Home /
GIP, rat

GIP, rat

Item no.	AS-65568-05
Manufacturer	AnaSpec
Amount	0.5 mg
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Leu-Thr-Gln-OH
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Glucose-dependent Insulinotropic Polypeptide,Gastric-inhibitory polypeptide,Glucose-dependent Insulinotropic Polypeptide,GIP rat GIP,Insulinotropic peptide
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Gastric Inhibitory Polypeptide (GIP)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	5003
Manufacturer - Research Area	Diabetes/Metabolism; Hormones; Cell Signaling / Incretins & related Hormones; Gastrointestinal Tract; GPCR
Description	GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet ?-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence One-Letter Code	YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535133382

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-65568-05-safety-datasheet.pdf