« Back
Home /
Nesfatin-1 (24-53), human - 0.5 mg

Nesfatin-1 (24-53), human - 0.5 mg

Item no.	AS-65571
Manufacturer	AnaSpec
Amount	0.5 mg
Category	Metabolism Regulation of Appetite Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Asp-Val-Leu-Glu-Thr-Asp-Lys-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-NH2
Citations	1. Feijoo-Bandin S., et.al., Endocrinology 154 (12), 4757-4767 (2013) 2. Vas S., et.al., PLOS 8 (4), 1-10 (2013) 3. Ramanjaneya M., et.al., Endocrinology 151 (7), 3169-3180 (2010)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	PDTGLYYDEYLKQVIDVLETDKHFREKLQK-NH2
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Nesfatin
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3684.4
Description	Nesfatin-1 was recently identified as an anorexigenic peptide and is derived from Nucleobindin2 protein. Nesfatin-1 reduces body weight gain, food and water intake in rodents. In humans high levels of Nesfatin-1 in plasma are associated with overweight individuals. In addition, Nesfatin-1 has been linked to anxiety and stress.
Product Group	LB1A1Z
Research Area	Hormones / Lyophilized
Sequence One-Letter Code	PDTGLYYDEYLKQVIDVLETDKHFREKLQK-NH2
GTIN	5400535160913
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-65571-safety-datasheet.pdf