« Back
Home /
SHLP3(Small humanin-like peptide 3)

SHLP3(Small humanin-like peptide 3)

Item no.	AS-65589
Manufacturer	AnaSpec
Amount	0.1 mg
Category	Oncology Neuroscience Neural Signaling By Cell Type Blastoma Sarcoma Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	NH2-Met-Leu-Gly-Tyr-Asn-Phe-Ser-Ser-Phe-Pro-Cys-Gly-Thr-Ile-Ser-Ile-Ala-Pro-Gly-Phe-Asn-Phe-Tyr-Arg-Leu-Tyr-Phe-Ile-Trp-Val-Asn-Gly-Leu-Ala-Lys-Val-Val-Trp-COOH
Citations	1. Cobb L. J. et al., AGING 8 (4), 796-808 (2016). 2. Okada A. K. et al., Sci Reports 7 (7802), 1-10 (2017). .
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	humanin peptide
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Small Humanin-Like Peptide (SHLP)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4380.4
Manufacturer - Research Area	Cell & Tissue Biology / Mitochondrial Biology
Description	Recent advances in high-resolution sequencing have led to the discovery of unique peptides derived from mitochondrial genome. 1-2 Currently 8 peptides are identified: humanin, mitochondrial open reading frame of the 12S tRNA-c (MOTS-c), and six small humanin-like peptides (SHLP1-6). 1-2 All of these peptides are released into cytosol from mitochondria. SHLP3 shares protective effects with Humanin, such as eduction in apoptosis, generation of reactive oxygen species and improving mitochondrial metabolism. In addition, it may participate in age-related disease pathology. 1-2
Sequence One-Letter Code	H - MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW - OH
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535175665

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-65589-safety-datasheet.pdf