« Back
Home /
Anti-RPA70 Antibody [ARC0773]

Anti-RPA70 Antibody [ARC0773]

Item no.	ANTI-A307959-100
Manufacturer	Antibodies.com
Amount	100 ul
Category	Antibodies Immunoprecipitation Western Blot Primary Antibodies CHiP
Type	Antibody Primary
Format	Liquid
Applications	WB, IP, CHIP
Clone	ARC0773
Specific against	Human (Homo sapiens), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Sequence	MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELE
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Manufacturer - Targets	RPA70
Storage Conditions	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Product Description	Rabbit monoclonal [ARC0773] antibody to RPA70.
Clonality	Monoclonal
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPA70/RPA1 (P27694).
Manufacturer - Formulation	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Purification	Affinity purification.
Recommended dilutions	WB: 1:500-1:2, 000, IP: 1:500-1:1, 000, ChIP: 1:500-1:1, 000
Molecular weight	70 kDa

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ul

available

Delivery expected until 1/15/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer