Comparison

Anti-Human Coronavirus Spike glycoprotein Antibody European Partner

Item no. ANTI-A308071-50
Manufacturer Antibodies.com
Amount 50 ul
Category
Type Antibody Primary
Format Liquid
Applications WB
Specific against Coronavirus
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Sequence NMVEFIQTSSPKVTIDCAAFVCGDYAACKSQLVEYGSFCDNINAILTEVNELLDTTQLQVANSLMNGVTLSTKLKDGVNFNVDDINFSPVLGCLGSECSKA
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Available
Specificity HCoV-OC43
Manufacturer - Targets
Human Coronavirus Spike glycoprotein
Storage Conditions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Product Description
Rabbit polyclonal antibody to Human Coronavirus Spike glycoprotein.
Clonality
Polyclonal
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 800-900 of coronavirus Spike S2 (YP_009555241.1).
Manufacturer - Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Purification
Affinity purification.
Recommended dilutions
WB: 1:500-1:1, 000
Molecular weight
75 kDa / 145 kDa

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ul
Available: In stock
available

Delivery expected until 11/20/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close