« Back
Home /
Anti-REEP1 Antibody

Anti-REEP1 Antibody

Item no.	75-313
Manufacturer	Antibodies Incorporated
Amount	100 uL
Category	Antibodies Immunocytochemistry Primary Antibodies Immunoblot
Type	Antibody Monoclonal
Format	Liquid
Applications	WB, IHC, ICC
Clone	N345/51
Specific against	Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG2b
Conjugate/Tag	Unconjugated
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)
Shipping Condition	Cool pack
Available
Manufacturer - Type	Primary Antibody
Manufacturer - Targets	REEP1
Country of Origin	United States
Shipping Temperature	Shipped on ice packs
Storage Conditions	Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.
Molecular Weight	22 kDa
Manufacturer - Research Area	Cell Signaling
Expiration	24 months from date of receipt
Immunogen	Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli
Immunogen Species	Mouse
Description	Our Anti-REEP1 mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone N345/51. It detects mouse and rat REEP1, and is purified by Protein A chromatography. It is great for use in IHC, ICC, WB.
Target Description	Receptor expression-enhancing protein 1, Receptor Accessory Protein 1 or REEP1 is encoded by the gene REEP1. The REEP protein family is made up of six REEP proteins 1-6. REEP1 is a mitochondrial protein that links ER tubules to the cytoskeleton and is involved in ER formation and remodeling. REEP1 is expressed in brain, spinal cord and testes. It is also expressed in olfactory sensory neurons and may play a role in the cell surface expression of odorant receptors. Diseases associated with this gene include Spastic Paraplegia distal hereditary motor neuropathy type V. Ref: Brain Res. 2014 January 30; 1545: 12–22. doi:10.1016/j.brainres.2013.12.008
Clonality	Monoclonal
Manufacturer - Specificity	Does not cross-react with REEP2
Concentration	1 mg/mL
Form	Purified by Protein A chromatography
Buffer	10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.125
Production Notes	Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody.
Quality Control	Each new lot of antibody is quality control tested by western blot on rat whole brain lysate and confirmed to stain the expected molecular weight band.
Quality Control: Application	WB Brain
Usage Statement	These antibodies are to be used as research laboratory reagents and are not for use as diagnostic or therapeutic reagents in humans.
Manufacturer - Statement	We produce our REEP1 mouse monoclonal primary antibody from hybridoma clone N345/51. It is great in IHC, ICC, WB and is purified by Protein A chromatography.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 uL

available

Delivery expected until 9/11/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer