Comparison

GluA2/GluR2 glutamate receptor

Item no. 73-002
Manufacturer Antibodies Incorporated
Amount 5 mL
Category
Type Antibody Monoclonal
Applications IHC, IB
Clone L21/32
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host Mouse
Isotype IgG1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Available
Manufacturer - Category
Receptors
Description
Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491)
Mouse: 98% identity (49/50 amino acids identical)
Human: 98% identity (49/50 amino acids identical)
100% identity between Flip and Flop isoforms
> 70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4
Expected Banding Pattern
90 kDa
Validation
T|Br-IB|Br-IHC|KO

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 mL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close