« Back
Home /
SUR1 and SUR2B

SUR1 and SUR2B

Item no.	73-298
Manufacturer	Antibodies Incorporated
Amount	5 mL
Category	Antibodies Immunocytochemistry Primary Antibodies Immunoblot
Type	Antibody Monoclonal
Applications	ICC, IB
Clone	N323A/31
Specific against	Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Mouse
Isotype	IgG1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Available
Manufacturer - Category	Receptors
Description	Immunogen: Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B (also known as Sulfonylurea receptor 2B, ATP-binding cassette transporter subfamily C member 9B and Abcc9B, accession number Q63563-2) Mouse: 100% identity (43/43 amino acids identical) Human: 97% identity (42/43 amino acids identical) > 75% identity with SUR1
Expected Banding Pattern	175 kDa (and smaller fragments likely due to proteolytic cleavage)
Validation	T\|Br-IB\|Br-IHC

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 5 mL

available

Delivery expected until 9/11/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer