ACE (Angiotensin-converting Enzyme, Dipeptidyl Carboxypeptidase I, Kininase II, CD143, Angiotensin-converting Enzyme, Soluble Form, DCP, DCP1) (Biotin)

Antibodies / Antibodies-Enzymes, Carboxypeptidase

-20°C

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

Partial recombinant corresponding to aa592-701 from human ACE (AAH36375) with GST tag. MW of the GST tag alone is 26kD.

ACE is an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Two most abundant alternatively spliced variants of this gene encode two isozymes-the somatic form and the testicular form that are equally active.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTREAPVYM

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 

Note: Applications are based on unconjugated antibody.