Comparison

CDK7 (Cell Division Protein Kinase 7, CDK-activating Kinase, CAK, TFIIH Basal Transcription Factor Complex Kinase Subunit, 39kD Protein Kinase, P39 Mo15, STK1, CAK1, MO15) (Biotin)

Item no. USB-124796-Biotin
Manufacturer United States Biological
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag Biotin
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Pab
Manufacturer - Category
Antibodies / Antibodies-Protein Kinases
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
EU Commodity Code
30021010
Immunogen
Full length human CDK7, aa1-346 (NP_001790.1).
Specificity
Recognizes human CDK7.
Description
CDK7, a CDC2/CDK type protein kinase, is the catalytic component of the Cdk-activating kinase (CAK) which acts as a regulator of cell cycle progression. CDK7 complexes with cyclin H and MAT1 to form CAK, and this multi-subunit protein phosphorylates the cyclin-dependent protein kinases CDC2/CDK1, CDK2, CDK4 and CDK6. CAK also associates with the transcription factor IIH (TFIIH) which functions in transcription initiation and DNA repair. TFIIH has been shown to be regulated by CDK8/cyclin C.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 

Note: Applications are based on unconjugated antibody.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close