Comparison

CORIN (Atrial Natriuretic Peptide-converting Enzyme,Pro-ANP-converting Enzyme,Corin,Heart-specific Serine Proteinase ATC2,Transmembrane Protease,Serine 10,Atrial Natriuretic Peptide-converting Enzyme,N-terminal Propeptid

Item no. USB-125235-PE
Manufacturer United States Biological
Amount 100 ul
Category
Type Antibody Monoclonal
Format Liquid
Applications WB
Clone 5B6
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG1
Conjugate/Tag PE
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Enzymes, Protease (Proteinase, Peptidase)
Shipping Temperature
Blue Ice
Storage Conditions
4°C Do Not Freeze
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
EU Commodity Code
30021010
Immunogen
Partial recombinant protein corresponding to aa616-715 from human CORIN with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human CORIN.
Description
CORIN is a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. This protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase.

Applications:
Suitable for use in FLISA and Western Blot. Other applications have not been tested.

Recommended Dilutions:
Optimal dilutions to be determined by the researcher.

AA Sequence:
CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.
Manufacturer - Full Name
CORIN (Atrial Natriuretic Peptide-converting Enzyme, Pro-ANP-converting Enzyme, Corin, Heart-specific Serine Proteinase ATC2, Transmembrane Protease, Serine 10, Atrial Natriuretic Peptide-converting Enzyme, N-terminal Propeptide, Atrial Natriuretic P

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close