G3BP1 (Ras GTPase-activating Protein-binding Protein 1, G3BP-1, ATP-dependent DNA Helicase VIII, hDH VIII, GAP SH3 Domain-binding Protein 1, G3BP)

Antibodies / Antibodies-GTPase, Rab, Ras, Rho Proteins

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant corresponding to aa214-303 from G3BP (AAH06997) with GST tag. MW of the GST tag alone is 26kD.

This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Applications:
Suitable for use in ELISA, Immunofluorescence, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
KPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRV

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.