HOXB9 (Homeobox B9, Homeobox Protein Hox-B9, Homeobox Protein Hox-2E, HOX2E, HOX2, Homeobox Protein Hox-2.5, HOX-2.5)

Antibodies / Antibodies-Transcription Factors, Homeobox (HOX)

-20°C

Supplied as a liquid in PBS, pH 7.2.

Full length human HOXB9, aa1-250 (NP_076922.1).

HOXB9 functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation, part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is expressed in whole embryos and fetuses at 5-9 weeks from conception.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.