ICOSL (B7-H2, CD275, ICOS Ligand, B7 Homolog 2, B7-like Protein Gl50, B7-related Protein 1, B7RP-1, ICOSLG, B7H2, B7RP1, KIAA0653) (FITC)

Antibodies / Antibodies-CD Markers

-20°C

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Partial recombinant corresponding to aa20-303 from ICOSLG (AAH64637) with GST tag. MW of the GST tag alone is 26kD.

B7-H2, or Inducible costimulator ligand (ICOSL), is a member of the Ig superfamily and belongs to the B7 family of costimulatory molecules. It specifically binds to ICOS, but not to other T cell costimulatory molecules such as CD28 and CTLA-4. B7-H2-ICOS interaction appears to be very important in the expansion of activated T cells and late-phase immune responses. B7-H2 enhances the proliferation of both CD4 and CD8 T cells, the secretion of Th1- and/or Th2-type cytokines, and the expression of CD154 (CD40 ligand) on T cells. It is expressed constitutively on B lymphocytes and at low levels on monocytes. Furthermore, B7-H2-ICOS interaction induces IL-10 production, which plays an important role in reducing immune responses.

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
TQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIG

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.