LMX1B (LIM Homeobox Transcription Factor 1-beta, LIM/Homeobox Protein 1.2, LMX-1.2, LIM/Homeobox Protein LMX1B, MGC138325, MGC142051) (FITC)

Mab

IgG2a, k

-20°C

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Partial recombinant corresponding to aa1-110 from human LMX1B (NP_002307) with GST tag. MW of the GST tag alone is 26kD.

Essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels.

Applications:
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
MLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRKLYCKQDYQQLFAAKCSGCMEKIAPTEFVMRALE

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.