LONRF2 (LON Peptidase N-terminal Domain and RING Finger Protein 2, Neuroblastoma Apoptosis-related Protease, RING Finger Protein 192, RNF192, FLJ45273, MGC126711, MGC126713)

Mab

IgG2a, k

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant protein corresponding to aa1-109 from human LONRF2 (NP_940863) with GST tag. MW of the GST tag alone is 26kD.

Applications:
Suitable for use in ELISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYCLALNPECNSVKKEAQKVMCEVLFSATANVHENLTSSIQSRLKAQGHSHMNAQALLEEGDA

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.