MAP2K6 (Dual Specificity Mitogen-activated Protein Kinase Kinase 6, MAP Kinase Kinase 6, MAPKK 6, MAPKK6, MKK6, PRKMK6, MAPK/ERK Kinase 6, MEK 6, MEK6, Stress-activated Protein Kinase Kinase 3, SAPK Kinase 3, SAPKK3, SAP

Mab

IgG2a, k

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant corresponding to aa231-335, from human MAP2K6 (AAH12009) with GST tag. MW of the GST tag alone is 26kD.

MKK6 is a novel mitogen-activated protein kinase kinase which is a member of the p38 kinase cascade and efficiently phosphorylates p38 but not c-Jun N-terminal kinase (JNK) and extracellular signal-regulated kinase (ERK) family members in direct kinase assays. The protein is strongly activated by UV, anisomycin, and osmotic shock. MKK6 exists in a variety of alternatively spliced isoforms with distinct patterns of tissue expression. The protein usually phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. Human MKK6 gene is mapped on chromosomal region 17q24.3.

Applications:
Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
QKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.