MYO3B (Myosin-IIIb)

Antibodies / Antibodies-Motor Proteins

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant protein corresponding to aa280-370 from human MYO3B (NP_620482) with GST tag. MW of the GST tag alone is 26kD.

Probable actin-based motor with a protein kinase activity.

Applications:
Suitable for use in ELISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
RRPSVTHLLDHPFIKGVHGKVLFLQKQLAKVLQDQKHQNPVAKTRHERMHTRRPYHVEDAEKYCLEDDLVNLEVLDEDTIIHQLQKRYAD

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.