Comparison

NR2F2 (COUP Transcription Factor 2, COUP-TF2, Apolipoprotein A-I Regulatory Protein 1, ARP-1, COUP Transcription Factor II, COUP-TF II, Nuclear Receptor Subfamily 2 Group F Member 2, ARP1, TFCOUP2) (FITC)

Item no. USB-130551-FITC
Manufacturer United States Biological
Amount 100 ul
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Conjugate/Tag FITC
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Pab
Manufacturer - Category
Antibodies / Antibodies-Receptors
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
EU Commodity Code
30021010
Immunogen
Full length human NR2F2, aa1-414 (NP_066285.1).
Specificity
Recognizes human NR2F2.
Description
COUP-TFII, a NR2 Hepatocyte NF4-Like receptor, has been shown to affect neuronal development and differentiation, homeostasis in various Human tissues, mesenchymal-epithelial interactions during organogenesis, and the development of the cardiovascular system. COUP-TFII interacts with and modulates several nuclear receptors, including estrogen receptor alpha (ER alpha), thyroid hormone receptors (TR), PPAR alpha, and retinoic acid receptors (RAR). Mice lacking COUP-TFII show abnormal heart and vascular development. COUP-TFII expression has been documented in Human adrenal, lung, kidney, liver, spleen, skeletal muscle, and breast. ESTs have been isolated from Human tissue libraries, including cancerous adrenal, bladder, brain, breast, colon, head/neck, kidney, lung, ovary, pancreas, pituitary, prostate, skeletal muscle, skin, smooth muscle, stomach, synovium, and uterus, and normal brain, adipose, adrenal, blood, brain, breast, cervix, ear, embryo, gallbladder, ganglion, heart, kidney, liver/spleen, lung, ovary, placenta, prostate, skin, spleen, testis, uterus, and vessel.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close