PCBP1 (Poly(rC)-binding Protein 1, Alpha-CP1, Heterogeneous Nuclear Ribonucleoprotein E1, Nucleic Acid-binding Protein SUB2.3)

Mab

IgG2a, k

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant corresponding to aa181-280 from human PCBP1 (AAH39742) with GST tag. MW of the GST tag alone is 26kD.

This intronless gene is thought to have been generated by retrotransposition of a fully processed PCBP-2 mRNA. This gene and PCBP-2 have paralogues (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. The protein encoded by this gene appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This encoded protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.

Applications:
Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
IPYQPMPASSPVICAGGQDRCSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQ

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.