PTK2B (Protein-tyrosine Kinase 2-beta, Calcium-dependent Tyrosine Kinase, CADTK, Cell Adhesion Kinase beta, CAK-beta, Focal Adhesion Kinase 2, FADK 2, Proline-rich Tyrosine Kinase 2, Related Adhesion Focal Tyrosine Kinase, RAFTK, FAK2, PYK2, RAF

Mab

IgG2b, k

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant corresponding to aa682-871 from human PTK2B (AAH36651) with GST tag. MW of the GST tag alone is 26kD.

PYK2 is involved in calcium induced regulation of ion channel and activation of the map kinase signaling pathway. PKY2 may represent an important signaling intermediate between neuropeptide activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. Interacts with the SH2 domain of Grb2. May phosphorylate the voltage-gated potassium channel protein Kv1.2. PYK2 activation is highly correlated with the stimulation of c-Jun N-terminal kinase activity. It's been shown to be involved in osmotic stress-dependent SNCA 'Tyr-125' phosphorylation.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
VYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTA

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.