Comparison

RAPGEF3 (CGEF1,EPAC,EPAC1,Rap Guanine Nucleotide Exchange Factor 3,Exchange Factor Directly Activated by cAMP 1,Exchange Protein Directly Activated by cAMP 1,Rap1 Guanine-nucleotide-exchange Factor Directly Activated by

Item no. USB-132310-APC
Manufacturer United States Biological
Amount 100 ul
Category
Type Antibody Monoclonal
Format Liquid
Applications WB
Clone 2E5
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2a
Conjugate/Tag APC
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-GTPase, Rab, Ras, Rho Proteins
Manufacturer - Isotype
IgG2a, k
Shipping Temperature
Blue Ice
Storage Conditions
4°C Do Not Freeze
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
EU Commodity Code
30021010
Immunogen
Partial recombinant corresponding to aa772-881 from RAPGEF3 (AAH17728) with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human RAPGEF3.
Description
Guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP.

Applications:
Suitable for use in Western Blot and FLISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
FMPLLLKDMTFIHEGNHTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.
Manufacturer - Full Name
RAPGEF3 (CGEF1, EPAC, EPAC1, Rap Guanine Nucleotide Exchange Factor 3, Exchange Factor Directly Activated by cAMP 1, Exchange Protein Directly Activated by cAMP 1, Rap1 Guanine-nucleotide-exchange Factor Directly Activated by cAMP, cAMP-regulated Gua

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close