RIT2 (RIN, ROC2, GTP-binding Protein Rit2, Ras-like Protein Expressed in Neurons, Ras-like Without CAAX Protein 2)

Antibodies / Antibodies-GTPase, Rab, Ras, Rho Proteins

-20°C

Supplied as a liquid in PBS, pH 7.2.

Full length human RIT2, aa1-217 (NP_002921.1).

GTP-binding protein Rit2 (Rit2; also Rin, Ras-like protein expressed in neurons, Ras-like without CAAX) is a 25kD member of the small GTPase superfamily and Ras family. Human Rit2 is 217aa in length. Like all small G-proteins, Rit2 contains five highly conserved domains (G1-G5) and acts as a molecular switch by alternating an active GTP-bound form and an inactive GDP-bound form. There are two isoforms for Rit2. Isoform 1 is the long form. Isoform 2 has an 11aa substitution for residues 143-153 found in isoform 1 and a deletion of aa154-217. Rit2 is expressed exclusively in neurons. In addition, Rit2 binds calmodulin through a C-terminal binding motif.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKRENMT

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.