Comparison

S100A10 (Protein S100-A10, Calpactin I Light Chain, Calpactin-1 Light Chain, Cellular Ligand of Annexin II, S100 Calcium-binding Protein A10, p10 Protein, p11, ANX2LG, CAL1L, CLP11, MGC111133) (FITC)

Item no. USB-132914-FITC
Manufacturer United States Biological
Amount 100 ul
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, IF
Clone 4D2-F1
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG1
Conjugate/Tag FITC
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Binding Proteins, Calcium
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
EU Commodity Code
30021010
Immunogen
Full-length recombinant corresponding to aa1-98 from human S100A10 (AAH15973) with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human S100A10.
Description
S100A10/p11 belongs to the S-100 calcium binding protein family, although it has had crucial aa substitutions and deletions that render it incapable of binding calcium. p11 forms a heterotetrameric complex with annexin II. p11 functions as an auxiliary protein and has been shown to interact directly the potassium channel TASK-1. It is essential for TASK1 trafficking to the plasma membrane. p11 also increases the localization of 5HT1B receptors to the cell surface.

Applications:
Suitable for use in FLISA, Western Blot and Immunofluorescence. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK*

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close