Comparison

SCN2B (Sodium Channel Subunit beta-2, UNQ326/PRO386) (PE)

Item no. USB-133024-PE
Manufacturer United States Biological
Amount 100 ul
Category
Type Antibody Monoclonal
Format Liquid
Applications ELISA
Clone 2G11-C12
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG1
Conjugate/Tag PE
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Ion Channel
Shipping Temperature
Blue Ice
Storage Conditions
4°C Do Not Freeze
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
EU Commodity Code
30021010
Immunogen
Full length recombinant corresponding to aa1-215 from human SCN2B with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human SCN2B.
Description
Scn2b encodes one type of beta subunit found in voltage-gated sodium channels. These channels, composed of one alpha and one or two different beta subunits, mediate changes in cell permeability to sodium ions that are essential for the generation of action potentials. Scn2b protein, comprised of an extracellular N-terminus with an immunoglobulin-like fold and a single transmembrane domain, has been shown in brain tissues to be covalently linked through disulfide bonds to the alpha subunit. Scn2b is considered an auxiliary subunit that modulates cell-surface expression and gating, though its function in heart myocytes may be limited to cell adhesion. Scnb2 null mice display increased susceptibility to seizures. Expression of Scn2b has been shown to be suppressed with exposure to pneumococcal acute otitis media.

Applications:
Suitable for use in FLISA. Other applications not tested.

Recommended Dilutions:
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close