SMAD2 (SMAD Family Member 2, SMAD 2, SMAD-2, hMAD-2, hSMAD2, JV18, JV18-1, MAD-related Protein 2, MADR2, MGC22139, MGC34440, Mothers Against Decapentaplegic Homolog 2, Mothers Against DPP Homolog 2, MAD Homolog 2, MADH2)

Mab

IgG2a, k

-20°C

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

Partial recombinant corresponding to aa181-280 from human SMAD2 (AAH25699) with GST tag. MW of the GST tag alone is 26kD.

SMAD2 is an intracellular protein belonging to the Dwarfin (DWA:B):SMAD family. SMAD2 associates with SMAD4 for translocation to nucleus. It acts as an intracellular mediator of TGFbeta family of cytokines and activin type 1 receptor (ACVR1C). Hence it regulates multiple cellular processes like cell growth, proliferation, differentiation, and apoptosis and also cooperates with transcription factors to regulate expression of defined genes. Apart from playing an important role in TGFbeta1-induced CTGF expression they also act as markers of EMT in human PTECs. It also acts as an integrator of multiple signals in the regulation of NOS3 expression. It is ubiquitously expressed in most of the tissues and is responsible for colorectal, hepatocellular, lung and breast carcinomas as well as cervical cancer.

Applications:
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 

Note: Applications are based on unconjugated antibody.