Comparison

SMAD2 (SMAD Family Member 2, SMAD 2, SMAD-2, hMAD-2, hSMAD2, JV18, JV18-1, MAD-related Protein 2, MADR2, MGC22139, MGC34440, Mothers Against Decapentaplegic Homolog 2, Mothers Against DPP Homolog 2, MAD Homolog 2, MADH2)

Item no. USB-133537-FITC
Manufacturer United States Biological
Amount 100 ul
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, IF, IHC
Clone 4D10
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2a
Conjugate/Tag FITC
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Smad Proteins
Manufacturer - Isotype
IgG2a, k
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
EU Commodity Code
30021010
Immunogen
Partial recombinant corresponding to aa181-280 from human SMAD2 (AAH25699) with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human SMAD2.
Description
SMAD2 is an intracellular protein belonging to the Dwarfin (DWA:B):SMAD family. SMAD2 associates with SMAD4 for translocation to nucleus. It acts as an intracellular mediator of TGFbeta family of cytokines and activin type 1 receptor (ACVR1C). Hence it regulates multiple cellular processes like cell growth, proliferation, differentiation, and apoptosis and also cooperates with transcription factors to regulate expression of defined genes. Apart from playing an important role in TGFbeta1-induced CTGF expression they also act as markers of EMT in human PTECs. It also acts as an integrator of multiple signals in the regulation of NOS3 expression. It is ubiquitously expressed in most of the tissues and is responsible for colorectal, hepatocellular, lung and breast carcinomas as well as cervical cancer.

Applications:
Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.
Manufacturer - Full Name
SMAD2 (SMAD Family Member 2, SMAD 2, SMAD-2, hMAD-2, hSMAD2, JV18, JV18-1, MAD-related Protein 2, MADR2, MGC22139, MGC34440, Mothers Against Decapentaplegic Homolog 2, Mothers Against DPP Homolog 2, MAD Homolog 2, MADH2) (FITC)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close