TNFSF11 (Tumor Necrosis Factor Ligand Superfamily Member 11,CD254,Osteoclast Differentiation Factor,ODF,Osteoprotegerin Ligand,OPGL,Receptor Activator of Nuclear Factor kappa-B Ligand,RANKL,TNF-related Activation-induced

Mab

IgG2b, k

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant corresponding to aa222-317 from TNFSF11 (NP_003692) with GST tag. MW of the GST tag alone is 26kD.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
FRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDI*

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.