U2AF1RS2 (U2 Small Nuclear Ribonucleoprotein Auxiliary Factor 35kD Subunit-related Protein 2,U2AF1-RS2,CCCH Type Zinc Finger,RNA-binding Motif and Serine/arginine Rich Protein 2,ZRSR2,Renal Carcinoma Antigen NY-REN-20,U2

Mab

IgG2a, k

4°C Do Not Freeze

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

Partial recombinant corresponding to aa294-394 from U2AF1L2 (NP_005080) with GST tag. MW of the GST tag alone is 26kD.

Applications:
Suitable for use in FLISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNG*

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.