USP3 (Ubiquitin-specific-processing Protease 3, Ubiquitin Carboxyl-terminal Hydrolase 3, Deubiquitinating Enzyme 3, Ubiquitin Thioesterase 3, UBP, SIH003)

Mab

IgG2a, k

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant corresponding to aa421-520 from USP3 (NP_006528) with GST tag. MW of the GST tag alone is 26kD.

Applications:
Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETVVKAKAYILFYVEHQAKAGSDKL

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.