SLC38A1 (Sodium-coupled Neutral Amino Acid Transporter 1, Amino Acid Transporter A1, N-system Amino Acid Transporter 2, Solute Carrier Family 38 Member 1, System A Amino Acid Transporter 1, System N Amino Acid Transporter 1, ATA1, NAT2, SAT1, SN

Antibodies / Antibodies-Ion Channel

-20°C

Supplied as a lyophilized powder in PBS. Reconstitute with 100ul dH2O to 1mg/ml.

Middle region of SLC38A1 corresponding to LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTN

aa transporters play essential roles in the uptake of nutrients, production of energy, chemical metabolism, detoxification, and neurotransmitter cycling. SLC38A1 is an important transporter of glutamine, an intermediate in the detoxification of ammonia and the production of urea. Glutamine serves as a precursor for the synaptic transmitter, glutamate.

Applications:
Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution:
Western Blot: 1.25ug/ml
Immunohistochemistry: 4-8ug/ml
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.