EPHA5 (EPH Receptor A5, CEK7, EHK1, HEK7, TYRO4, Eph Homology Kinase-1, Ephrin Receptor EphA5, Ephrin Type-A Receptor 5, Receptor Protein-Tyrosine Kinase HEK7, Tyrosine-Protein Kinase Receptor EHK-1) (FITC)

Mab

IgG3, k

-20°C

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Recombinant protein corresponding to aa234-333 from human EPHA5 with GST tag. MW of the GST tag alone is 26kD.

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Two transcript variants encoding different isoforms have been found for this gene.

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
PSVVRHLAVFPDTITGADSSQLLEVSGSCVNHSVTDEP PKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRP GFFKASPHIQSCGKCPPHSYTHEEAS

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: Applications are based on unconjugated antibody.