Comparison

EPHA7 (EPH Receptor A7, EHK3, HEK11, OTTHUMP00000016875, OTTHUMP00000040586, Ephrin Receptor EphA7, Ephrin Type-A Receptor 7, Receptor Protein-Tyrosine Kinase HEK11, Tyrosine-Protein Kinase Receptor EHK-3)

Item no. USB-207594
Manufacturer United States Biological
Amount 200 ul
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, ELISA
Clone 3D11
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgM
Purity Ascites
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Receptor Tyrosine Kinases
Manufacturer - Isotype
IgM, k
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Ascites
Form
Supplied as a liquid.
EU Commodity Code
30021010
Immunogen
Recombinant protein corresponding to aa1-279 from full-length human EPHA7 with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human EPHA7.
Description
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close