Comparison

FYN (FYN Oncogene Related to SRC, FGR, YES, OKT3-induced Calcium Influx Regulator, OTTHUMP00000017914, OTTHUMP00000017915, OTTHUMP00000017917, C-syn protoOncogene, Protein-Tyrosine Kinase fyn, Proto-Oncogene Tyrosine-Protein Kinase fyn, Src-like

Item no. USB-207650-PE
Manufacturer United States Biological
Amount 100 ul
Category
Type Antibody Monoclonal
Format Liquid
Applications WB
Clone 3A8
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG2b
Conjugate/Tag PE
Purity Purified
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Protein Kinases
Manufacturer - Isotype
IgG2b, k
Shipping Temperature
Blue Ice
Storage Conditions
4°C Do Not Freeze
Grade
Purified
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
EU Commodity Code
30021010
Immunogen
Recombinant protein corresponding to aa1-90 from human FYN with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human FYN.
Description
This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTP QHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHT GTLRTRGGTGVTLFVAL

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.
Manufacturer - Full Name
FYN (FYN Oncogene Related to SRC, FGR, YES, OKT3-induced Calcium Influx Regulator, OTTHUMP00000017914, OTTHUMP00000017915, OTTHUMP00000017917, C-syn protoOncogene, Protein-Tyrosine Kinase fyn, Proto-Oncogene Tyrosine-Protein Kinase fyn, Src-like Kina

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close