Comparison

FMR1 (Fragile X Mental Retardation 1, FMRP, FRAXA, MGC87458, POF, POF1) (APC)

Item no. USB-246234-APC
Manufacturer United States Biological
Amount 100 ul
Category
Type Antibody Monoclonal
Format Liquid
Applications WB
Clone 3.0e+11
Specific against other
Host Mouse
Isotype IgG1
Conjugate/Tag APC
Purity Purified
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-RNA Binding Proteins
Shipping Temperature
Blue Ice
Storage Conditions
4°C Do Not Freeze
Grade
Purified
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
EU Commodity Code
30021010
Immunogen
Partial recombinant protein corresponding to aa121-220 form human FMR1 with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human FMR1.
Description
The protein encoded by this gene binds RNA and is associated with polysomes. The encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). [provided by RefSeq

Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
ATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMRNEEASKQLESSRQLASRFH

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close