Comparison

HOXB7 (Homeobox B7, HHO.C1, HOX2, HOX2C, Hox-2.3)

Item no. USB-247222
Manufacturer United States Biological
Amount 100 ug
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, ELISA
Clone 4F9
Specific against other
Host Mouse
Isotype IgG1
Purity Purified
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Transcription Factors, Homeobox (HOX)
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Purified
Form
Supplied as a liquid in PBS, pH 7.4.
EU Commodity Code
30021010
Immunogen
HOXB7 (NP_004493, 55aa-120aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human HOXB7.
Description
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close