MED13L (Mediator Complex Subunit 13-like, DKFZp781D0112, FLJ21627, KIAA1025, PROSIT240, THRAP2, TRAP240L) (APC)

Mab

IgG2a, k

4°C Do Not Freeze

Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).

MED13L (NP_056150, 1186aa-1285aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

The evolutionarily conserved THRAP genes encode a family of proteins that regulate embryonic development. THRAP2 is involved in early development of the heart and brain (Muncke et al., 2003 [PubMed 14638541]).[supplied by OMIM

Applications:
Suitable for use in FLISA, Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
IFGKNSDIGQAAERRLMMCQSTFLPQVEGTKKPQEPPISLLLLLQNQHTQPFASLNFLDYISSNNRQTLPCVSWSYDRVQADNNDYWTECFNALEQGRQY

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.