NR2F2 (Nuclear Receptor Subfamily 2, Group F, Member 2, ARP1, COUP-TFII, COUPTFB, MGC117452, SVP40, TFCOUP2) (APC)

Mab

IgG2a, k

4°C Do Not Freeze

Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).

NR2F2 (NP_066285, 153aa-240aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Mouse monoclonal antibody raised against a partial recombinant NR2F2.

Applications:
Suitable for use in FLISA. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
RMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD

Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.