Comparison

PDS5, Regulator of Cohesion Maintenance, Homolog B (PDS5B, APRIN, CG008, FLJ23236, KIAA0979, RP1-267P19.1)

Item no. USB-P3126-25
Manufacturer United States Biological
Amount 100 ug
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, Dot
Clone 8C261
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG1
Purity Purified by Protein G affinity chromatography from hybridoma culture supernatant
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Proteins
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.4, 1% BSA, 0.05% sodium azide.
EU Commodity Code
30021010
Immunogen
Partial sequence of recombinant full-length protein to human PDS5, Regulator of Cohesion Maintenance, Homolog B consisting of amino acids from the C-terminal portion of the protein (Sequence: QWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSGPPAPEEEEEEERQSGNTEQKSKSKQHRVSRRAQQRAESPESSAIESTQSTPQKGRGRPSKTPSP)
Specificity
Recognizes human PDS5, Regulator of Cohesion Maintenance, Homolog B.
Description
APRIN plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis.

Applications:
Suitable for use in Dot Blot and Western Blot. Other applications have not been tested.

Recommended Dilution:
Optimal dilution to be determined by the researcher.

Storage and Stability:
May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile glycerol (40-50), aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close