« Back
Home /
MT-CYB Rabbit pAb

MT-CYB Rabbit pAb

Item no.	A9762-500uL
Manufacturer	Abclonal
Amount	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	NMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGLY
NCBI	mt-Cytb
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CYTB, MT-CYB
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background	Predicted to enable metal ion binding activity and ubiquinol-cytochrome-c reductase activity. Predicted to be involved in several processes, including electron transport coupled proton transport; mitochondrial electron transport, ubiquinol to cytochrome c; and response to glucagon. Located in membrane and mitochondrion. Is integral component of mitochondrial inner membrane. Human ortholog(s) of this gene implicated in ovarian carcinoma and urinary bladder cancer. Orthologous to human MT-CYB (mitochondrially encoded cytochrome b).
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 3-103 of mouse MT-CYB (NP_904340.1).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	43kDa
Route	Synthetic peptide
Manufacturer - Research Area	Signal Transduction, Endocrine & Metabolism, Mitochondrial metabolism, Cytochromes, Neuroscience, Neurodegenerative Diseases

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A9762-500uL-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer