Comparison

Anti-HMGB1 Picoband Antibody

Item no. ABC-ABO10014
Manufacturer Abcepta
Amount 100 ug
Category
Type Antibody Primary
Format Lyophilized
Applications WB, IHC-P
Specific against other
Host Rabbit
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Similar products HMGB1, HMG1, High mobility group protein B1, High mobility group protein 1, HMG-1
Available
Primary Accession
P09429
Application
WB, IHC-P
Clonality
Polyclonal
Gene ID
3146
Reactivity
H, M, Rat
Legend image 1
Western blot analysis of HMGB1 expression in rat brain extract (lane 1), mouse ovary extract (lane 2), 22RV1 whole cell lysates (lane 3) and HELA whole cell lysates (lane 4). HMGB1 at 25KD was detected using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody (Catalog #ABO10014) at 0.5 μg/mL. The blot was developed using chemiluminescence (ECL) method .
Type image 1
WB
Dilution image 1
0.1-0.5 µg/ml
Legend image 2
HMGB1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody (Catalog # ABO10014) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
Type image 2
IHC
Dilution image 2
0.5-1 µg/ml
Legend image 3
HMGB1 was detected in paraffin-embedded sections of mouse liver tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody (Catalog # ABO10014) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
Type image 3
IHC
Legend image 4
HMGB1 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody (Catalog # ABO10014) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
Type image 4
IHC
Legend image 5
HMGB1 was detected in paraffin-embedded sections of rat liver tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody (Catalog # ABO10014) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
Type image 5
IHC
Legend image 6
HMGB1 was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody (Catalog # ABO10014) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
Type image 6
IHC
Legend image 7
HMGB1 was detected in paraffin-embedded sections of human placenta tissues using rabbit anti- HMGB1 Antigen Affinity purified polyclonal antibody (Catalog # ABO10014) at 1 μg/mL. The immunohistochemical section was developed using SABC method .
Type image 7
IHC
Calculated MW
24894
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description
Rabbit IgG polyclonal antibody for High mobility group protein B1(HMGB1) detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Protein Function
Multifunctional redox sensitive protein with various roles in different cellular compartments. In the nucleus is one of the major chromatin-associated non-histone proteins and acts as a DNA chaperone involved in replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair and genome stability. Proposed to be an universal biosensor for nucleic acids. Promotes host inflammatory response to sterile and infectious signals and is involved in the coordination and integration of innate and adaptive immune responses. In the cytoplasm functions as sensor and/or chaperone for immunogenic nucleic acids implicating the activation of TLR9-mediated immune responses, and mediates autophagy. Acts as danger associated molecular pattern (DAMP) molecule that amplifies immune responses during tissue injury. Released to the extracellular environment can bind DNA, nucleosomes, IL-1 beta, CXCL12, AGER isoform 2/sRAGE, lipopolysaccharide (LPS) and lipoteichoic acid (LTA), and activates cells through engagement of multiple surface receptors. In the extracellular compartment fully reduced HMGB1 (released by necrosis) acts as a chemokine, disulfide HMGB1 (actively secreted) as a cytokine, and sulfonyl HMGB1 (released from apoptotic cells) promotes immunological tolerance (PubMed:23519706, PubMed:23446148, PubMed:23994764, PubMed:25048472). Has proangiogdenic activity (By similarity). May be involved in platelet activation (By similarity). Binds to phosphatidylserine and phosphatidylethanolamide (By similarity). Bound to RAGE mediates signaling for neuronal outgrowth (By similarity). May play a role in accumulation of expanded polyglutamine (polyQ) proteins such as huntingtin (HTT) or TBP (PubMed:23303669, PubMed:25549101). .
Subcellular Localization
Nucleus . Chromosome . Cytoplasm . Secreted . Cell membrane ; Peripheral membrane protein ; Extracellular side . Endosome . Endoplasmic reticulum-Golgi intermediate compartment . In basal state predominantly nuclear. Shuttles between the cytoplasm and the nucleus (PubMed:12231511, PubMed:17114460). Translocates from the nucleus to the cytoplasm upon autophagy stimulation (PubMed:20819940). Release from macrophages in the extracellular milieu requires the activation of NLRC4 or NLRP3 inflammasomes (By similarity). Passively released to the extracellular milieu from necrotic cells by diffusion, involving the fully reduced HGMB1 which subsequently gets oxidized (PubMed:19811284). Also released from apoptic cells (PubMed:16855214, PubMed:18631454). Active secretion from a variety of immune and non-immune cells such as macrophages, monocytes, neutrophils, dendritic cells and natural killer cells in response to various stimuli such as LPS and cytokines involves a nonconventional secretory process via secretory lysosomes (PubMed:12231511, PubMed:14532127, PubMed:15944249). Secreted by plasma cells in response to LPS (By similarity). Found on the surface of activated platelets (PubMed:11154118). .
Tissue Specificity
Ubiquituous. Expressed in platelets (PubMed:11154118). .
Protein Name
High mobility group protein B1
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
Purification
Immunogen affinity purified.
Cross Reactivity
No cross reactivity with other proteins
Storage
At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close