« Back
Home /
Anti-IAPP Antibody

Anti-IAPP Antibody

Item no.	ANTI-A14211-100
Manufacturer	Antibodies.com
Amount	100ul
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Liquid
Applications	IHC, ICC
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Sequence	MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Product Description	Rabbit polyclonal antibody to Amylin / DAP.
Clonality	Polyclonal
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-89 of human IAPP (NP_000406.1).
Product form	Liquid
Formulation	Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Purification	Affinity purification.
Storage	Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Recommended dilutions	IHC: 1:50-1:200, ICC/IF: 1:50-1:200
Target	Amylin / DAP

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ul

available

Delivery expected until 8/28/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer